Cart summary

You have no items in your shopping cart.

CABYR Peptide - middle region

CABYR Peptide - middle region

Catalog Number: orb1998327

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998327
CategoryProteins
DescriptionCABYR Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: EQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESV
UniProt IDO75952
MW54 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCT88, FSP2, CBP86, FSP-2, CABYRa, CABYRc, CABYRe,
Read more...
NoteFor research use only
NCBINP_036321.2