C7orf43 Rabbit Polyclonal Antibody

SKU: orb583480

Description

Rabbit polyclonal antibody to C7orf43

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C7orf43
• Target: C7orf43
• Protein Sequence: Synthetic peptide located within the following region: DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL
• Molecular Weight: 62kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MAP11, MCPH25, C7orf43

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. C7orf43 is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-C7orf43 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

C7orf43

UniProt

Q8WVR3

RefSeq (Protein):NP_060745