C4BPB antibody

• Catalog Number: orb329748
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C4BPB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Human, Porcine
• Reactivity: Canine, Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C4BPB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: C4BPB
• UniProt ID: P20851
• Protein Sequence: Synthetic peptide located within the following region: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
• NCBI: NP_000707
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C4BP antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human kidney tissue using C4BPB antibody

Western blot analysis of human 721_B tissue using C4BPB antibody

Western blot analysis of human Liver tissue using C4BPB antibody