C4BPB Rabbit Polyclonal Antibody

SKU: orb329748

Description

Rabbit polyclonal antibody to C4BPB

Research Area

Immunology & Inflammation, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Canine, Porcine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C4BPB
• Target: C4BPB
• Protein Sequence: Synthetic peptide located within the following region: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
• Molecular Weight: 28kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C4BP antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, C4BPB is supported by BioGPS gene expression data to be expressed in 721_B.

Human kidney

WB Suggested Anti-C4BPB Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

C4BPB

UniProt

P20851

RefSeq (Protein):NP_000707