You have no items in your shopping cart.
Cart summary
Item 1 of 1
C1RL Rabbit Polyclonal Antibody
Catalog Number: orb586772
| Catalog Number | orb586772 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to C1RL |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Mouse |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human C1RL |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 54kDa |
| Target | C1RL |
| UniProt ID | Q9NZP8 |
| Protein Sequence | Synthetic peptide located within the following region: KVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPI |
| NCBI | NP_057630 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | C1RL1, C1RLP, CLSPa, C1r-LP Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-C1RL Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.
- Item 1 of 1
C1RL Rabbit Polyclonal Antibody [orb155970]
WB
Human, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
