C1QBP Rabbit Polyclonal Antibody

SKU: orb584558

Description

Rabbit polyclonal antibody to C1QBP

Research Area

Apoptotic, Cancer, Epigenetics, Immunology, Infectious Diseases, Neuroscience, Signaling Pathways

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QBP
Target	C1QBP
Protein Sequence	Synthetic peptide located within the following region: VVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESE
Molecular Weight	31 kDa
Purification	Affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

p32, HABP1, gC1qR, GC1QBP, SF2p32, gC1Q-R, COXPD33, SF2AP32

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-C1QBP antibody Titration: 1 ug/ml, Sample Type: Human Stomach Tumor.

Quick Database Links

Gene Symbol

C1QBP

UniProt

Q07021

RefSeq (Protein):NP_001203.1

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001203.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols