C10orf71 Rabbit Polyclonal Antibody

• Catalog Number: orb587208
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C10orf71
• Target: C10orf71
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C10orf71
• Protein Sequence: Synthetic peptide located within the following region: AERSSYENKEVEGELEMGPAGSSWCPDSREHRPRKHLSLRLCNRDPEPGG
• UniProt ID: Q711Q0
• MW: 79kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CEFIP
• Note: For research use only

Sample Type: HCT15 Whole cell lysates, Antibody dilution: 1.0 ug/ml.