BUB1B monoclonal antibody (M03), clone 3F2

• Catalog Number: orb2295338
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BUB1B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F2
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
• NCBI: AAH18739
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BUB1B monoclonal antibody (M03), clone 3F2 Western Blot analysis of BUB1B expression in Hela S3 NE.

Detection limit for recombinant GST tagged BUB1B is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml].

Western Blot detection against Immunogen (39.93 KDa).