You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295338 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant BUB1B. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 3F2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH18739 |
BUB1B monoclonal antibody (M03), clone 3F2 Western Blot analysis of BUB1B expression in Hela S3 NE.
Detection limit for recombinant GST tagged BUB1B is approximately 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml].
Western Blot detection against Immunogen (39.93 KDa).