BUB1B monoclonal antibody (M02J), clone 2G5

• Catalog Number: orb2295339
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BUB1B.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
• Tested applications: ELISA, IHC-P, PLA, WB
• Clone Number: 2G5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH18739

BUB1B monoclonal antibody (M02J), clone 2G5. Western Blot analysis of BUB1B expression in Hela S3 NE.

Detection limit for recombinant GST tagged BUB1B is 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-BUB1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody (M02J), clone 2G5. Lane 1: BUB1B transfected lysate (Predicted MW: 119.5 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BUB1B monoclonal antibody (M02) clone 2G5 (Cat # orb2295340). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (39.93 KDa).