BUB1B monoclonal antibody (M02J), clone 2G5

• Catalog Number: orb2295339
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BUB1B.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G5
• Tested applications: ELISA, IHC-P, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
• NCBI: AAH18739
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BUB1B monoclonal antibody (M02J), clone 2G5. Western Blot analysis of BUB1B expression in Hela S3 NE.

Detection limit for recombinant GST tagged BUB1B is 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-BUB1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody (M02J), clone 2G5. Lane 1: BUB1B transfected lysate (Predicted MW: 119.5 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BUB1B monoclonal antibody (M02) clone 2G5 (Cat # orb2295340). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (39.93 KDa).