BUB1B monoclonal antibody (M01A), clone 2G9

• Catalog Number: orb2295341
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BUB1B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
• NCBI: AAH18739
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BUB1B monoclonal antibody (M01A), clone 2G9. Western Blot analysis of BUB1B expression in human spleen.

Western Blot detection against Immunogen (39.93 KDa).