BTG2 Rabbit Polyclonal Antibody

• Catalog Number: orb574729
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BTG2
• Target: BTG2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BTG2
• Protein Sequence: Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV
• UniProt ID: P78543
• MW: 17kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PC3, APRO1, TIS21
• Note: For research use only
• NCBI: NP_006754

WB Suggested Anti-BTG2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.