BTG2 Rabbit Polyclonal Antibody

• Catalog Number: orb574728
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BTG2
• Target: BTG2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BTG2
• Protein Sequence: Synthetic peptide located within the following region: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY
• UniProt ID: P78543
• MW: 17kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PC3, APRO1, TIS21
• Note: For research use only
• NCBI: NP_006754

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

WB Suggested Anti-BTG2 Antibody Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate, BTG2 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.