Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Bovine TGFB1 protein
Catalog Number orb244583
ConjugationUnconjugated
Target TGFB1
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Purity >90% as determined by SDS-PAGE.
MW 16.9 kDa
Source E. coli
Uniprot ID P18341
Product Description

Recombinant Bos taurus (Bovine) Transforming growth factor beta-1

Application Notes
Application Notes Partial of the full length of 279-390aa Transforming growth factor beta-1 chain of His-tag and expression region is 279-390aa
Reviews
Write Your Own Review
You're reviewing:Bovine TGFB1 protein - orb244583
Your Rating