Bovine CXCL10 Recombinant Protein

• Catalog Number: orb1820890
• Category: Proteins
• Description: The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 9.3 kDa
• Target: CXCL10
• Entrez: 615107
• Protein Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA
• Protein Length: 83
• Source: Yeast
• Storage: -20°C
• Alternative names: IP-10
• Note: For research use only
• Expiration Date: 6 months from date of receipt.