Bola1 Rabbit Polyclonal Antibody

• Catalog Number: orb576290
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Bola1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bola1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 14kDa
• Target: Bola1
• UniProt ID: Q9D8S9
• Protein Sequence: Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE
• NCBI: NP_081251
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 1810037G04Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Bola1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.