Bmp2 Rabbit Polyclonal Antibody

SKU: orb579383

Description

Bmp2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Bmp2. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Rat. This antibody reacts with Rat samples and is predicted to react with Canine, Equine, Porcine. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Canine, Equine, Porcine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Target: Bmp2
• Protein Sequence: Synthetic peptide located within the following region: EEKPGVSKRHVRISRSLHQDEHSWSQVRPLLVTFGHDGKGHPLHKREKRQ
• Molecular Weight: 44kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Bmp2

WB Suggested Anti-Bmp2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Rat Heart.

Quick Database Links

Gene Symbol

Bmp2

UniProt

P49001

RefSeq (Protein):NP_058874