PCGF4 Rabbit Polyclonal Antibody

SKU: orb324520

Description

Rabbit polyclonal antibody to BMI1

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCGF4
• Target: BMI1
• Protein Sequence: Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
• Molecular Weight: 37kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti PCGF4 antibody, anti RNF51 antibody, anti FLVI2/BMI1 antibody

Human myeloma cell

WB Suggested Anti-PCGF4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: A172 cell lysate, BMI1 is supported by BioGPS gene expression data to be expressed in A172.

Quick Database Links

Gene Symbol

BMI1

UniProt

P35226

RefSeq (Protein):NP_005171