You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295475 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human BLVRA protein. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | IF, WB |
Reactivity | Human |
Immunogen | BLVRA (NP_000703.2, 1 a.a. ~ 296 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
NCBI | NP_000703.2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
BLVRA MaxPab polyclonal antibody. Western Blot analysis of BLVRA expression in HeLa.
BLVRA MaxPab polyclonal antibody. Western Blot analysis of BLVRA expression in human liver.
Immunofluorescence of purified MaxPab antibody to BLVRA on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot analysis of BLVRA expression in transfected 293T cell line by BLVRA MaxPab polyclonal antibody. Lane 1: BLVRA transfected lysate(32.56 KDa). Lane 2: Non-transfected lysate.