BIRC5 monoclonal antibody (M01), clone 5B10

• Catalog Number: orb2295993
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BIRC5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5B10
• Tested applications: ELISA, IF, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: BIRC5 (NP_001159, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE
• NCBI: NP_001159
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged BIRC5 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to BIRC5 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoprecipitation of BIRC5 transfected lysate using anti-BIRC5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BIRC5 MaxPab rabbit polyclonal antibody.

Western Blot analysis of BIRC5 expression in transfected 293T cell line by BIRC5 monoclonal antibody (M01), clone 5B10. Lane 1: BIRC5 transfected lysate(16.4 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of BIRC5 over-expressed 293 cell line, cotransfected with BIRC5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BIRC5 monoclonal antibody (M01), clone 5B10 (Cat # orb2295993). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).