You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402408 |
---|---|
Category | Antibodies |
Description | Bile Acid Receptor NR1H4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human NR1H4 (442-486aa QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 55914 MW |
UniProt ID | Q96RI1 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Bile acid receptor;Farnesoid X-activated receptor; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A549 cells using anti-NR1H4 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of NR1H4 using anti-NR1H4 antibody.Lane 1:human HCCT tissue; 2:human HCCP tissue.
IF analysis of NR1H4 using anti-NR1H4 antibody. NR1H4 was detected in immunocytochemical section of A549 cells.
FC, WB | |
Bovine, Canine, Equine, Porcine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating