Bhlhb4 Rabbit Polyclonal Antibody

• Catalog Number: orb324703
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Bhlhe23
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bhlhb4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: Bhlhe23
• UniProt ID: Q8BGW3
• Protein Sequence: Synthetic peptide located within the following region: MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA
• NCBI: NP_542372
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti A930001L02Rik antibody, anti BETA4 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Bhlhb4 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Brain.