BGLAP monoclonal antibody (M01), clone 2D4

• Catalog Number: orb2295515
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BGLAP.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D4
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 lambda
• Immunogen: BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
• NCBI: NP_954642
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged BGLAP is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to BGLAP on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of BGLAP expression in transfected 293T cell line by BGLAP monoclonal antibody (M01), clone 2D4. Lane 1: BGLAP transfected lysate(11 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (31.13 KDa).