You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389435 |
---|---|
Category | Antibodies |
Description | Beta Tubulin/TUBB Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Gallus, Human, Monkey, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat, Chicken Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry(Fixed), 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 50433 MW |
UniProt ID | P07437 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Tubulin beta chain; Tubulin beta-5 chain; TUBB; TU Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-Beta Tubulin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of SiHa cells using anti-Beta Tubulin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Beta III Tubulin using anti-Beta III Tubulin antibody.Lane 1:human HeLa cell; 2:human SH-SY5Y cell; 3:human HepG2 cell; 4:rat brain tissue; 5:rat C6 cell; 6:mouse brain tissue; 7:mouse 3T3-L1 cell.
IHC analysis of Beta III Tubulin using anti-Beta III Tubulin antibody. Beta III Tubulin was detected in paraffin-embedded section of human mammary cancer tissues.
IHC analysis of Beta III Tubulin using anti-Beta III Tubulin antibody. Beta III Tubulin was detected in paraffin-embedded section of human glioma tissues.
FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating