Beta Tubulin/TUBB Antibody

• Catalog Number: orb389435
• Category: Antibodies
• Description: Beta Tubulin/TUBB Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Gallus, Human, Monkey, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat, Chicken Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry(Fixed), 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 50433 MW
• UniProt ID: P07437
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Tubulin beta chain; Tubulin beta-5 chain; TUBB; TU
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-Beta Tubulin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of SiHa cells using anti-Beta Tubulin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Beta III Tubulin using anti-Beta III Tubulin antibody.Lane 1:human HeLa cell; 2:human SH-SY5Y cell; 3:human HepG2 cell; 4:rat brain tissue; 5:rat C6 cell; 6:mouse brain tissue; 7:mouse 3T3-L1 cell.

IHC analysis of Beta III Tubulin using anti-Beta III Tubulin antibody. Beta III Tubulin was detected in paraffin-embedded section of human mammary cancer tissues.

IHC analysis of Beta III Tubulin using anti-Beta III Tubulin antibody. Beta III Tubulin was detected in paraffin-embedded section of human glioma tissues.