Beta Tubulin TUBB Antibody (monoclonal, 2E11)

• Catalog Number: orb610920
• Category: Antibodies
• Description: Beta Tubulin TUBB Antibody (monoclonal, 2E11)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E11
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG2a
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
• Concentration: 0
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence,2μg/ml,Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55 kDa
• UniProt ID: P07437
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Tubulin beta chain; Tubulin beta-5 chain; TUBB; TU
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

IF analysis of Tubulin beta using anti-Tubulin beta antibody and anti-FOSB antibody.

Flow Cytometry analysis of HEPA1-6 cells using anti-Tubulin beta antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of U937 cells using anti-Tubulin beta antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.

IF analysis of Tubulin beta using anti-Tubulin beta antibody.

IF analysis of Tubulin beta using anti-Tubulin beta antibody.

WB analysis using anti-Tubulin beta antibody.Lane 1:rat brain tissue, Lane 2:rat liver cell, Lane 3:rat PC-12 cell, Lane 4:mouse brain cell, Lane 5:mouse NIH3T3 cell, Lane 6:mouse RAW264.7 cell.

WB analysis using anti-Tubulin beta antibody.Lane 1:HEK293 tissue, Lane 2:monkey COS-7 cell, Lane 3:PC-3 cell, Lane 4:HeLa cell