You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
BDNF purified MaxPab rabbit polyclonal antibody (D01P)
Catalog Number: orb2295522
| Catalog Number | orb2295522 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human BDNF protein. |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | BDNF (NP_733927.1, 1 a.a. ~ 255 a.a) full-length human protein. |
| Protein Sequence | MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Tested applications | PLA, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_733927.1 |
Proximity Ligation Analysis of protein-protein interactions between BDNF and NTF4. HeLa cells were stained with anti-BDNF rabbit purified polyclonal 1:1200 and anti-NTF4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF MaxPab polyclonal antibody. Lane 1: BDNF transfected lysate(28.90 KDa). Lane 2: Non-transfected lysate.
