You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295522 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human BDNF protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | BDNF (NP_733927.1, 1 a.a. ~ 255 a.a) full-length human protein. |
Protein Sequence | MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Tested applications | PLA, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_733927.1 |
Proximity Ligation Analysis of protein-protein interactions between BDNF and NTF4. HeLa cells were stained with anti-BDNF rabbit purified polyclonal 1:1200 and anti-NTF4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF MaxPab polyclonal antibody. Lane 1: BDNF transfected lysate(28.90 KDa). Lane 2: Non-transfected lysate.