You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295524 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human BDNF protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | BDNF (AAH29795, 1 a.a. ~ 247 a.a) full-length human protein. |
Protein Sequence | MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH29795 |
BDNF MaxPab polyclonal antibody. Western Blot analysis of BDNF expression in NIH/3T3.
Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF MaxPab polyclonal antibody. Lane 1: BDNF transfected lysate(27.28 KDa). Lane 2: Non-transfected lysate.