BCS1L monoclonal antibody (M01), clone 5F3

• Catalog Number: orb2295536
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BCS1L.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: BCS1L (NP_004319, 320 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLR
• Tested applications: ELISA, WB
• Clone Number: 5F3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004319

Western Blot analysis of BCS1L expression in transfected 293T cell line by BCS1L monoclonal antibody (M01), clone 5F3. Lane 1: BCS1L transfected lysate(47.534 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).