BCL7A antibody

• Catalog Number: orb330925
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BCL7A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BCL7A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: BCL7A
• UniProt ID: Q4VC05
• Protein Sequence: Synthetic peptide located within the following region: CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
• NCBI: NP_066273
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BCL7 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Lung tissue using BCL7A antibody

Western blot analysis of human Fetal Brain tissue using BCL7A antibody

Western blot analysis of human Fetal Heart tissue using BCL7A antibody