BCL11A Rabbit Polyclonal Antibody

• Catalog Number: orb577178
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BCL11A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BCL11A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 91kDa
• Target: BCL11A
• UniProt ID: Q9H165
• Protein Sequence: Synthetic peptide located within the following region: YACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDR
• NCBI: NP_075044
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EVI9, CTIP1, DILOS, ZNF856, HBFQTL5, BCL11A-L, BCL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 3 ug/ml.

WB Suggested Anti-BCL11A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: PANC1 cell lysate.