You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| CAS Number | 463930-25-8 |
|---|---|
| MW | 3742.29 Da |
| Purity | > 95% by hplc |
| Formula | C167H270N52O46 |
| Protein Sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2 |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−463930-25-8, Bay 55-9837, HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2,
Similar Products
−Bay 55-9837 acetate [orb1296377]
98.27% (May vary between batches)
3802.30
1 mg, 5 mg, 10 mg, 25 mg, 50 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide