Bax Rabbit Polyclonal Antibody

SKU: orb584142

Description

Bax Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Bax. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Rat Bax. This antibody reacts with Rat samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Bax
• Target: Bax
• Protein Sequence: Synthetic peptide located within the following region: PQDASTKKLSECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMF
• Molecular Weight: 21kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Sample Type: Rat Testis lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

Bax

UniProt

G3V8T9

RefSeq (Protein):NP_058755