Bax Antibody

• Catalog Number: orb389460
• Category: Antibodies
• Description: Bax Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, RatImmunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 21184 MW
• UniProt ID: Q07812
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Apoptosis regulator BAX;Bcl-2-like protein 4;Bcl2-
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-Bax antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Bax using anti-Bax antibody.Lane 1:rat thymus tissue;2:mouse thymus tissue;3:HEPA1-6 cell;4:HELA cell;5:MCF-7 cell.

IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of human lung cancer tissues.

IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of rat intestine tissues.

IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of human intetsinal cancer tissues.

IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of mouse intestine tissues.