BATF3 monoclonal antibody (M04), clone 3H1

• Catalog Number: orb2291033
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant BATF3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H1
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: BATF3 (NP_061134.1, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
• NCBI: NP_061134.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged BATF3 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to BATF3 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 monoclonal antibody (M04), clone 3H1. Lane 1: BATF3 transfected lysate (Predicted MW: 14.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (40.9 KDa).