You have no items in your shopping cart.
Cart summary
Item 1 of 1
Bacteria omp protein
Catalog Number: orb604740
| Catalog Number | orb604740 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rickettsia rickettsii 17 kDa surface antigen(omp) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGKGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P0A3N5 |
| MW | 21.5 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Rickettsia rickettsii |
| Expression Region | 20-159aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | omp17 kDa surface antigen |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Bacteria ompP2 protein [orb604938]
Greater than 85% as determined by SDS-PAGE.
44.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Bacteria Actinia equina DELTA-actitoxin-Aeq1a protein [orb604523]
Greater than 85% as determined by SDS-PAGE.
18.7 kDa
E.coli
20 μg, 100 μg, 1 mg 
