AURKC Rabbit Polyclonal Antibody

SKU: orb582127

Description

Rabbit polyclonal antibody to AURKC

Research Area

Epigenetics

Images & Validation

−

Item 1 of 1

Reactivity	Human
Predicted Reactivity	Human

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK
Target	AURKC
Molecular Weight	36 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Disclaimer	For research use only

Alternative Names

−

AIE2, AIK3, ARK3, AurC, SPGF5, STK13, HEL-S-90, aurora-C

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Large Intestine, Antibody dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

AURKC

UniProt

Q9UQB9

RefSeq (Protein):NP_001015878

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001015878

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols