ATP7B monoclonal antibody (M01), clone 3E10

• Catalog Number: orb2295635
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP7B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
• NCBI: NP_000044
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP7B monoclonal antibody (M01), clone 3E10. Western Blot analysis of ATP7B expression in human colon.

Detection limit for recombinant GST tagged ATP7B is approximately 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.08 KDa).