ATP6V1B2 Rabbit Polyclonal Antibody

SKU: orb583107

Description

Rabbit polyclonal antibody to ATP6V1B2

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1B2
• Target: ATP6V1B2
• Protein Sequence: Synthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG
• Molecular Weight: 56kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DOOD, HO57, VATB, VPP3, Vma2, ZLS2, ATP6B2, ATP6B1B2

WB Suggested Anti-ATP6V1B2 Antibody, Positive Control: Lane 1: 80 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.

WB Suggested Anti-ATP6V1B2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate.

Quick Database Links

Gene Symbol

ATP6V1B2

UniProt

P21281

RefSeq (Protein):NP_001684