You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295655 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ATP6V1A. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ATP6V1A (NP_001681, 508 a.a. ~ 617 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 4F5 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001681 |
ATP6V1A monoclonal antibody (M02), clone 4F5. Western Blot analysis of ATP6V1A expression in human kidney.
Detection limit for recombinant GST tagged ATP6V1A is 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ATP6V1A on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml].
Western Blot analysis of ATP6V1A expression in transfected 293T cell line by ATP6V1A monoclonal antibody (M02), clone 4F5. Lane 1: ATP6V1A transfected lysate (Predicted MW: 68.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.84 KDa).