ATP6V1A monoclonal antibody (M02), clone 4F5

• Catalog Number: orb2295655
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP6V1A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F5
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ATP6V1A (NP_001681, 508 a.a. ~ 617 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED
• NCBI: NP_001681
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP6V1A monoclonal antibody (M02), clone 4F5. Western Blot analysis of ATP6V1A expression in human kidney.

Detection limit for recombinant GST tagged ATP6V1A is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ATP6V1A on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml].

Western Blot analysis of ATP6V1A expression in transfected 293T cell line by ATP6V1A monoclonal antibody (M02), clone 4F5. Lane 1: ATP6V1A transfected lysate (Predicted MW: 68.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).