You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291765 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ATP6V0D1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 2G12 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004682 |
ATP6V0D1 monoclonal antibody (M01), clone 2G12 Western Blot analysis of ATP6V0D1 expression in HeLa.
Detection limit for recombinant GST tagged ATP6V0D1 is approximately 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]
Western Blot analysis of ATP6V0D1 expression in transfected 293T cell line by ATP6V0D1 monoclonal antibody (M01), clone 2G12. Lane 1: ATP6V0D1 transfected lysate (40.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (33.55 KDa).