ATP6V0D1 monoclonal antibody (M01), clone 2G12

• Catalog Number: orb2291765
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP6V0D1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G12
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN
• NCBI: NP_004682
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ATP6V0D1 monoclonal antibody (M01), clone 2G12 Western Blot analysis of ATP6V0D1 expression in HeLa.

Detection limit for recombinant GST tagged ATP6V0D1 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]

Western Blot analysis of ATP6V0D1 expression in transfected 293T cell line by ATP6V0D1 monoclonal antibody (M01), clone 2G12. Lane 1: ATP6V0D1 transfected lysate (40.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (33.55 KDa).