You have no items in your shopping cart.
Cart summary
Item 1 of 1
ATP5PO Rabbit Polyclonal Antibody
Catalog Number: orb588218
| Catalog Number | orb588218 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ATP5PO |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen for Anti-ATP5O antibody is: synthetic peptide directed towards the N-terminal region of Human ATPO |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 23 kDa |
| Target | ATP5PO |
| UniProt ID | P48047 |
| Protein Sequence | Synthetic peptide located within the following region: AASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITA |
| NCBI | NP_001688.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | ATPO, OSCP, ATP5O, HMC08D05 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ATPO antibody Titration: 1 ug/ml, Sample Type: Human Ovary Tumor.
- Item 1 of 2
ATP5PO Antibody [orb629557]
ELISA, FC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg 
