ATP2A2 Rabbit Polyclonal Antibody

SKU: orb579395

Description

Rabbit polyclonal antibody to ATP2A2

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Monkey, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATP2A2
• Target: ATP2A2
• Protein Sequence: Synthetic peptide located within the following region: VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV
• Molecular Weight: 115kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DD, DAR, ATP2B, SERCA2

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: ATP2A2, Gene Name: APLP2.

WB Suggested Anti-ATP2A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

ATP2A2

UniProt

P16615

RefSeq (Protein):NP_733765