ATG16L1 antibody

• Catalog Number: orb330735
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATG16L1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66kDa
• Target: ATG16L1
• UniProt ID: Q676U5
• Protein Sequence: Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
• NCBI: NP_060444
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti APG16L antibody, anti ATG16L antibody, anti F
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Liver tissue using ATG16L1 antibody

Western blot analysis of human Placenta tissue using ATG16L1 antibody

Western blot analysis of human brain tissue using ATG16L1 antibody