You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290615 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant ASXL1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ASXL1 (AAH64984.1, 1 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR |
Tested applications | ELISA, WB |
Clone Number | 6E2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH64984.1 |
ASXL1 monoclonal antibody (M05), clone 6E2. Western Blot analysis of ASXL1 expression in K-562.
Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.