ASPA MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2295769
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ASPA protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human, Mouse
• Immunogen: ASPA (NP_000040.1, 1 a.a. ~ 313 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
• NCBI: NP_000040.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in human liver.

ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in mouse liver.

Immunoprecipitation of ASPA transfected lysate using anti-ASPA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ASPA purified MaxPab mouse polyclonal antibody (B01P) (orb2295770).

Western Blot analysis of ASPA expression in transfected 293T cell line by ASPA MaxPab polyclonal antibody. Lane 1: ASPA transfected lysate(35.70 KDa). Lane 2: Non-transfected lysate.