ASL purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295782
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ASL protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: ASL (NP_000039.2, 1 a.a. ~ 464 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
• NCBI: NP_000039.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in human liver.

ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in mouse kidney.

Western Blot analysis of ASL expression in transfected 293T cell line by ASL MaxPab polyclonal antibody. Lane 1: ASL transfected lysate(51.70 KDa). Lane 2: Non-transfected lysate.