You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295782 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ASL protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ASL (NP_000039.2, 1 a.a. ~ 464 a.a) full-length human protein. |
Protein Sequence | MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000039.2 |
ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in human liver.
ASL MaxPab rabbit polyclonal antibody. Western Blot analysis of ASL expression in mouse kidney.
Western Blot analysis of ASL expression in transfected 293T cell line by ASL MaxPab polyclonal antibody. Lane 1: ASL transfected lysate(51.70 KDa). Lane 2: Non-transfected lysate.