ASH2L Rabbit Polyclonal Antibody

• Catalog Number: orb574988
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ASH2L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASH2L
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: ASH2L
• UniProt ID: Q9UBL3
• Protein Sequence: Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD
• NCBI: NP_004665
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ASH2, Bre2, ASH2L1, ASH2L2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-ASH2L antibody, Catalog Number: orb574988, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ASH2L Antibody, Titration: 2.5 ug/ml, Positive Control: Jurkat Whole Cell, ASH2L is supported by BioGPS gene expression data to be expressed in Jurkat.