ASH2L Rabbit Polyclonal Antibody

SKU: orb574986

Description

ASH2L Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ASH2L. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ASH2L. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASH2L
• Target: ASH2L
• Protein Sequence: Synthetic peptide located within the following region: AAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFN
• Molecular Weight: 69kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ASH2, Bre2, ASH2L1, ASH2L2

Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ASH2L antibody (orb574986).

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ASH2L antibody (orb574986).

WB Suggested Anti-ASH2L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

ASH2L

UniProt

Q9UBL3

RefSeq (Protein):NP_004665