Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ASGR1 Rabbit Polyclonal Antibody

SKU: orb574829

Description

ASGR1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ASGR1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middlel region of human ASGR1. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middlel region of human ASGR1
TargetASGR1
Protein SequenceSynthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Molecular Weight33 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HL-1, ASGPR, ASGPR1, CLEC4H1

Similar Products

  • ASGR1 Rabbit Polyclonal Antibody [orb574828]

    WB

    Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • ASGR1 Rabbit Polyclonal Antibody [orb4635]

    ELISA,  IHC-P,  WB

    Bovine, Equine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • ASGR1 Antibody (N-term) [orb1935129]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • ASGR1 Rabbit Polyclonal Antibody [orb624906]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • ASGPR1 Rabbit Polyclonal Antibody (Biotin) [orb526077]

    WB

    Human

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ASGR1 Rabbit Polyclonal Antibody

WB Suggested Antibody Titration: 0.2-1 ug/ml, Positive Control: Liver.

ASGR1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be glycosylated and/or lipidated.

ASGR1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Positive control (+): Human brain (BR), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001662

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ASGR1 Rabbit Polyclonal Antibody (orb574829)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry