ARPC1B Rabbit Polyclonal Antibody

SKU: orb586342

Description

Rabbit polyclonal antibody to ARPC1B

Research Area

Cell Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ARPC1B
• Target: ARPC1B
• Protein Sequence: Synthetic peptide located within the following region: KKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGS
• Molecular Weight: 41kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ARC41, IMD71, PLTEID, p40-ARC, p41-ARC

WB Suggested Anti-ARPC1B Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.

Quick Database Links

Gene Symbol

ARPC1B

UniProt

O15143

RefSeq (Protein):NP_005711