ARL3 Rabbit Polyclonal Antibody

• Catalog Number: orb584409
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARL3
• Target: ARL3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARL3
• Protein Sequence: Synthetic peptide located within the following region: QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP
• UniProt ID: P36405
• MW: 20kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RP83, ARFL3, JBTS35
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_004302

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. ARL3 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-ARL3 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell. ARL3 is supported by BioGPS gene expression data to be expressed in MCF7.