ARL13B Rabbit Polyclonal Antibody

SKU: orb330698

Description

Rabbit polyclonal antibody to ARL13B

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL13B
• Target: ARL13B
• Protein Sequence: Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
• Molecular Weight: 48 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ARL2L1 antibody, anti DKFZp686E2075 antibody, anti DKFZp686L2472 antibody, anti DKFZp686M2074 antibody, anti DKFZp761H079 antibody, anti MGC120611 antibody, anti MGC120612 antibody, anti JBTS8 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The 49 kDa peptide is also present in 37 kDa isoforms. The protein may be modified by lipidation and/or sumoylation.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Positive control (+): Lung tumor (T-LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ARL13B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.

Quick Database Links

Gene Symbol

ARL13B

UniProt

Q8TCL5

RefSeq (Protein):NP_659433